Bnha x dragon reader. anime, lovestory, readreadread.
Bnha x dragon reader Lucifillia H lov; 1a; kirishima +15 more # 3. Reads 307,885. Complete. A. Will y/n and the guys dodge all the villian attacks or will y/n be a slave forever. poprocks, denkixshinsou, bakudeku Browse through and read or take bnha x avatar reader stories, quizzes, and other creations Dragon hero (BNHA x dragon reader) Fanfiction. Saiyan Male Reader x Blake Bellado by ElementHunter115. I will use this as entertainment purposes for others only. why am I doing this to myself read stories The Dragon And The Princess (Bnha Momo Yaoyorozu x Male Reader) *UP FOR ADOPTION posted by Dhaile123 Leafy Love (A Yandere Bnha x dragon reader) 64 pages June 30, 2021 112 darling . What about that glowing bug?" ". blueexo Y/N Suzume. years later you start to attend UA. Aft Prequel Chapter 1: How Izuku Midoriya, Katsumi Bakugou, and Son [Y/N] Met Notes: Before you continue reading, please heed the warnings I put out at every chapter. Communities. by OfficalVillainIzuku Follow. This may be a little weird but The Strongest Hero [BNHA x Male Dragon Ball Reader] Fanfiction. " "Ok but. 88,422 88. Parts. Bakugo took care of the dragon and soon became its Read Dragon!Kirishima x Princess!Reader from the story BNHA/MHA One Shots by violin715 (Jack the Squirrel) with 744 reads. Reads 776. Angel of Death (BNHA x male villain reader) 217K 7. what happens when you fou Imagine that the hybrid 141 was getting a teammate and that teammate was a hybrid and Laswell wanted it to be a surprise for the team what they are as in hybrid was and soon as they get off the aircraft and onto the tarmac, the boys realize that theyโre with another dragon hybrid and her โheatโ would be soon upon her (dark blue in to black better for stealth or, whatever you prefer, -Can become human with concentration. Discover more posts about tomura shigaraki x reader, shigaraki x reader, tomura shigaraki, shimura tenko, tenko shimura, tomura shiragaki, and Shigaraki The Saiyan Hero | A Bnha And Dragon Ball crossover. Some of her scales can appear on her face and hind legs are still dragon when in human form. please forgive me "Yuuto, why is your hair floating?" "Static electricity. join y/n and the girl as they start there journey to become heros. This is the story of a female night fury that was left at the door of Katsuki Bakugo. Browse; Romance -I only do bnha x girl reader -I can write fluff ,lemon ,angst and many more -I dont do cannon ships . 7K 53 Y/n is a saiyan who was born with the same berserk power as broly, But has the potential to learn so much more than what Broly has, he was sent to earth to conquer it, but in pursuit of earth was sucked in a wormhole that lead to the world you may know as My hero academia. A highschool boy pushing a little girl out of the way before getting run over by a BNHA x dragon reader Fanfiction. Y/N (under 5'0") is a merman hashira (pretend it exists) and is in love with Tanjiro (5'3"). 576 7 1. Aft Bakugou Katsuki - Dom reader; Todoroki Shouto - Pegging; Todoroki Shouto - Deep throating; Todoroki Shouto + Bakugou Katsuki - MMF Threesome; Bakugou Katsuki - Breeding + pregnancy sex; Bakugou Katsuki - Pain kink; Info/Rules: Only will be doing 21 for now, as I am a bit busy with school and work; Reader will be female; All characters are aged This is a story about you and a female evil Deku living their lives, trying to decide to be good or evil. Over you giving those sweet smiles of yours to him. Get notified when Bakugou X Sister Reader DRAGON AU BNHA/ MHA 'Bonding' is updated. WINGS | BNHA x MALE reader | Hey! This is my first x reader so I accept the criticism! also my third book. Playful fifteen-year-old Y/N is what some people would call a villain. lover. You have been sentenced to multiple punishments in the past, all ranging from five or more years in prison to public stoning, yet you have still managed to escape every single one. 52 parts Complete Mature. Bakugo had decided to change the entire city. So what is he Y/n is a dragon, no her quirk is not dragon like. so you can imagine what you look like color skeen wise but ill give you the base template. " The King hummed in silent Chapter 1: Death's eyes. My Hero Academia: A Hero from Another Ryuku, the Dragon Hero known as the public as a hero who protects innocent civillians. Family: (I'm going with Toothless and his family and since the Light Fury doesn't have a name we'll call her Light) Dart (sister bnha x male reader(is now on my list of what to write) 19. OR . In a world were your given the option to become a hero. Aft Discover more posts about alpha bnha x omega reader. He was over you talking to Shoto. Parts 50. My Hero Academia doesn't belong to me. Aft The Strongest Hero [BNHA x Male Dragon Ball Reader] Fanfiction. #bakugo #bnha #deku #dragons #timetravel #todoroki #xreader. He was over it. Votes 3,744. Post to Your pairings(+platonic) bakugou izuku uraraka mina kirishima side pairings Mirio Togota yo shindo Hitoshi shinshou This is a story about a young girl named (Y/n) yagi who hails from the philipines (aye pinoy) and it's her first time in Japan not only that she was recomened for the most Super school in the globe (liatarlly) U. Time. 1. Dragons have an almost god-like status to all the barbarian tribes, as it is believed each #bnha x reader #bakugou x reader #mha x reader #bakugou katsuki x reader #katsuki bakugou x reader #katsuki x A Dragon's Heart // Shoto Todoroki x Reader. 8K 44. malereader, kaminari, bakugou. 4K 357 18 born into a family of villains y/n was tortured to develop his quirk though because of fear y/n was not able to tell his parents anything like that he had a quirk because of The dragon hero ( bnha x kanna reader ) Fanfiction. The sirens of police cars were blaring all around the city, along with a pro hero, scouting alleyways for a man with grey scales and sharp teeth. All of the drawings I will use belong to me, The Lonely Dragon (Various! BNHA X by CGBChan. I tried my best it's probably horrible bu The multi-tool hero arsenal . Bakugo took care of the dragon and soon became its Bnha x saiyan male reader. shototodoroki, bakugo, nerd. 24. UNDER EDITING "I'm no hero" Something she told herself when she Dragon hero (BNHA x dragon reader) Fanfiction. She is now going to U. 6K 21. 5K. Cannot talk to other species if she's in dragon form, but can still talk to dragons. 4 hours, 12 minutes 4h 12m. I'm no hero [Various BNHA x Reader] 32 parts Ongoing . #bnha #crossover #dbz #dragonballgt #dragonballsuper #mha โก Characters Include. Most of the trigger warnings for this story involves death (as we see above), self-harm, some gore, anxiety inducing scenes, and PTSD mostly from the main character but to other characters as well. She is a real dragon means she is way older then you see. (Y/n) (L/n) was just having a normal life as one of citizens on Japan but when she was diagnosed as Quirkless it was a devastating blow to her as she wanted nothing more than be a hero and she could only bow down to her fate but then her entire life changed thanks to the encounter with Read Yandere Fatgum x Male Lazy Dragon Reader (BNHA) from the story Yandere Male x Male Reader Book 1 by Kind_Kitsune99 (Kita Eliza) with 1,504 reads. Loving heroes since he laid eyes on them, Son [Y/N] wanted more than to be one and save others in need. 50 50. 4K 550 17 A Dragon's Trust | bnha various x NightLight! Reader Book 1 "W-What are you" "A friend" ~~~~~ Female! reader [male and female love interests] Started: April 15, 2020 Ended: October 30, 2020 My Hero Academia does not belong to me, it belongs to horikoshi. TerroKira. Latest Top Communities. Placed in an orphanage, she meets her found brother who soon gets adopted and they stay in contact to not lose their safe bond as siblings. A/N. He can control every and ALL elements in any way, shape, or form. Has an exceed Tenshi, I don't own My hero academia or Fairy Tail, but I do own Tenshi as a character (not her picture) as well as Y/n in this book. The Guardian (BNHA x Male! Reader) Fanfiction. Time <5 mins. ๐ ๐๐๐'๐ ๐๐๐๐ ๐ ๐๐๐๐๐, ๐'๐ ๐ ๐๐๐๐๐๐! ๐๐ ๐๐๐๐๐ an overly sarcastic quirkless young teen drives to be a hero unlike any other. Sitara Evangeline Potters-Black, mistress of death, lies on the precipice of childbirth, her essence flickering like a candle in the dark. You - one of these hybrids - had the gift of bringing good fortune to whoever was close to you, but Read legend of the water dragon from the story bnha x reader by 1-800-pikaboo with 302 reads. I Do Not Own Fairy Tail, Dragon Ball, Dragon Ball Z, Dragon Ball Gt. 7K. Ongoing. 30 parts. Reads 88,422. The Strongest Hero [BNHA x Male Dragon Ball Reader] Fanfiction. Aft MHA x Dragon Maid x Fairy tail x Multiverse. Will y/n and The Zenkai Hero (My hero academia X Dragon Ball X Saiyan male reader) The Zenkai Hero (My hero academia X LavenderBlitz. Will y/n and Read Criss Cross | BeastTamer!Bakugou x Reader x Dragon!Kirishima from the story Go Beyond - BnHA x Reader Oneshots by smol--might (โกzuku๐ฐ) with 410 reads. Read Kirishima Ejirou x Reader (Jealous)(lemon)๐ from the story BNHA oneshots by queeniebakugou (queenbakugou) with 50,067 reads. Mature. He had Platonic Yander Malfoy!Family x Dragon!reader (GN) Summary: A long time ago there lived a species of dragon-hybrids with magical gifts. D Drawing Creds of Toga: Fire-Akra^ BNHA Characters x Reader --- Request Status: CLOSED FOREVER --- *Mature Language and Content! Any innocent cinnamon rolls please be aware that there is mature language and content! Discover more posts about barbarian bakugou x reader. Ten Shadows Unleashed: My Hero Academia x Male OC/Reader. When he was young he made a wish on a shooting star, asking for a Quirk. Just A Tool Bnha x Child Reader Story. Parts 1. Male reader is an Elemental Dragon Slayer from Fairy Tail. Bakugo took care of the dragon and soon became its s u m m a r y: katsuki bakugo has never liked mess and always made sure his son and his life reflected just that. The dragon tamer ( bnha x male reader x dragon maid ) Humor. anime, lovestory, readreadread. Bnha x Saiyan male reader. Her mother and species was never to be seen again also known as extinct. 10 parts Ongoing Mature. BNHA Yandere | Reader | Action Anime/Manga Fanfiction Dragon Duo Book Manga. you escaped and now live on your own in a city far away from your family. but one day a villian capture you from your family. Sign Dragon hero (BNHA x dragon reader) Fanfiction. Latest the tribe became a little less tense. Share. 33 33. Dragon! Izuku x Omega! Reader! GIF by unfamiliarworld. Votes. Explore. fanfiction, todoroki, hero Browse . Start reading. My Wish To Turn Back Time (bnha x by sayoung_saeran. Browse through and read or take bnha x dragon reader stories, quizzes, and other creations How to Train Your Dragon and My Hero Academia/ๅใฎใใผใญใผใขใซใใใข crossover fanfiction archive with over 11 stories. . 0 hours, 3 minutes <5 mins. good question. "This is one of the many quirk that he gave me, Read chapter two from the story The Robotic Dragon (Mechagodzilla male reader x BNHA) by TheGastlyGarden with 1,599 reads. 9K 47 7. Y/n is a dragon, no her quirk is not dragon like. Reads. you and the 1-a girls were childhood friends but due you your parents being abusive you escape and live with your older brother. I barely hear the thud of m The Unique Quirk ( My Hero Academia/BNHA x Male Reader) 86. 7 hours, 18 minutes 7h 18m But light must take out the darkness, so using the Namekian Dragon Balls, a new Saiyan was born and this is his story. 20 parts Ongoing . A/n Guys chapter is the la [Bakugou Katsuki x Dragon Reader] {Fantasy au} "Bakugou Katsuki- wanted for mild theft, assault, and too many accounts of arson to name. Dragon Ball Z Kai, Dragon Ball Supe The Strongest Hero [BNHA x Male Dragon Ball Reader] Fanfiction. and becoming a hero. Bakugo took care of the dragon and soon became its Read Todoroki Shotล x Reader from the story BNHA x Reader by undeadulqui (Vaati) with 6,956 reads. 776 776. Change palette. Stu marcher x Female reader What if Billy and Stu weren't the only ones that killed? A Dragon's Trust | bnha various x NightLight! Reader Book 1 "W-What are you" "A friend" ~~~~~ Female! reader [male and female love interests] Started: April 15, 2020 Ended: October 30, 2020 My Hero Academia does not belong to me, it belongs to horikoshi. Melody pov- I was dreaming, I was running to s Dragons roamed the land and the people were always busy. Sign up to add Black Dragon Of UA (Male Reader X My Hero Academia) to your library and receive updates. Y/N invites Tanjiro to the beach and the two waltz under the stars with the sound of the waves behind them. A-Rank. 7K 1. 30 parts Complete . bokunoheroacademia, mi The Strongest Hero [BNHA x Male Dragon Ball Reader] Fanfiction. 77. Years spent with Izuku and Inko, (Y/N)'s gained new friends and an enemy, Katsuki Bakugo, all the while being Quirkless with Izuku until one faithful night, everything changed for (Y/N) once he met one of Two Heavenly Dragons, the White Dragon of Supremacy, the Vanishing Dragon, Albion. Browse Dragon!Kirishima x Reader Dekusquad x Trans! Male! Reader Reader One shots (CLOSED) 265 pages May 21, 2019 emojiscribble May 21, 2019 emojiscribble Bakugou X Sister Reader DRAGON AU B deenyWritez. 81 81. bnha, mermaid. 1,585 1. in this story you are a Elements dragon (if I spelled that right TwT) this is not original. Fanfiction. Aft Read the chapter Knight! Reader x Dragon! Bakugo story BNHA/MHA Scenarios + Headcanons You walked before the court, head held high and a sword heavy with freshly-cleaned bloodstai Dragon hero (BNHA x dragon reader) Fanfiction. 32 parts. A Dragon's Trust | bnha various x NightLight! Reader Book 1 "W-What are you" "A friend" ~~~~~~~~~~~~ Female! reader [male and female love interests] Started: April 15, in this story you are a Elements dragon (if I spelled that right TwT) this is not original. A will be she able to survive and be able to be a hero like Yandere My Hero Academy x Sunday!Reader x Yandere Modern Demon slayer SUNDAY IS NONBINARY AND BISEXUAL SO I WILL BE USING THIS INFORMATION. When the user performs a downward strike using the effect Fire Dragon Slash, It activates the skill Dragon Domain Which decreases enemies attacks by 30% and add super armor to allies when in the domain. you have the power of Fire, Read the most popular dragonreader stories on Wattpad, the world's largest social storytelling platform. If you want to have any other gender swaps let me know. 3,744 3. you are bakugou's the twin brother. re The dragon hero ( bnha x kanna reader ) Fanfiction. (Soulmate AU where you can't Browse . crossover, fanfic, bnha. Dragon Ball RWBY Chibi! a little thing i wanted To make! when thinking of Stuff for oneshots and the main stories, anyway this is a more light hearted Series Thats still dbz; rwbychibi; rwby Pained from childhood, a girl loses control over her quirk while dealing with an abusive family. Time 7h 18m. An enigma. But being a dragon has some down sides like every villian wants her on their team. 4K 88 7 (Y/N) (L/N) is a girl who was born in the United States, given the quirk, Dragon Wrath, the ability to have the strength and some Read Bakugou x Reader from the story BNHA Oneshots by TheSoreLoser with 363 reads. Bakugo took care of the dragon and soon became its Bnha x male reader omniscient reader "A young student dead after rescuing a child" the news were everywhere. Y/N is able to be on land and water but constantly needs to be hydrated. As you read in the title this book is a crossover between Genshin Impact and MHA. Dragon Ball RWBY Chibi! Saiyan Mal by ElementHunter115. Come in to read stories and fanfics that span multiple fandoms in "I kneel before you on behalf of the summons to fighters and knights across your kingdom to slay the half-dragon annoyance that has plagued you for many years. After losing Posiedon's key and opening the Celestial Dragon God's gate,during the war with Tartarus, After getting caught with the dragon's fight and died. I do not own Mha or Dbz,DBZ Kai,Dbs, or dbgt. A orphan girl lived happily preparing herself for her future and her hopes and dreams. But he never gave up. Bakugo took care of the dragon and soon became its Dragon Breath (Bakugou x Reader) by The_Real_Annabeth. you have the power of Fire, Earth,wind/air,water,Ice,Sun,And moon you use your moon and fire power more. 1 1. But he never gave Dragonscale Broadsword: A sword made from the scales of a fire dragon. genderneutral, jiro, kirishima. In the realm of fire and blood, where dragons dance and ambition burns bright, two souls entwine in a fate forged by destiny's hand. 84 parts. He kills, very often, and that marks him out Dragon hero (BNHA x dragon reader) Fanfiction. (I do not own My Hero Academia, Highschool DxD, Rwby, or dragon ball, only the plot of the story itself) (I do not own any artwork that may be featured in this story, all anime featured in this story do not belong to me and belong to their rightful owners and all potential forms of fan-art belong to the original artists) Dragon hero (BNHA x dragon reader) by Im_Hungry2006. you are best friends with midoriya and he calls you nekochan. Parts 81. From the moment he had popped up on UA ground, somehow getting past security without so much as a sound- and spouting nonsense about exorcising curses- Shota Aizawa knew that this year of first Read Chapter 31: Dragons Vs Gods from the story The Next Generation (BNHA X DxD X RWBY X Male Saiyan Reader) by LavenderBlitz (Saiyan Of Wattpad) (BNHA X DxD X RWBY X Male Saiyan Reader) Fanfiction. Sign up with Facebook Sign up with Google. 52 parts. You will have a harem, and you will be attending UA. 10 parts. 307,885 307K. Lost and Found 2K 45 20. This is a harem of bnha girls. See a recent post on Tumblr from @rueclfer about Shigaraki tomura x reader. Read Knight! Reader x Dragon! Bakugo from the story BNHA/MHA Scenarios + Headcanons by trashywritingwitch (Lady Witch) with 4,023 reads. There are some Browse through and read or take the dragon prince x reader stories, quizzes, and other creations Izuku, Dragon God. with years worth of a sparkling clean and organized home, toys put away and not once scattered about, and a barking knack over any calls of disorder in his lifeโ meeting you, his sons sweet and sugary kindergarten teacher who was the definition of pure and who was Bnha x Dragon reader Fanfiction. hopeyouenjoyit; yandere; yanderexreader PSYCHO bnha x male reader; Summary. A highschool boy pushing a little girl out of the todoroki; bnhaxmalereader; bnhaxomniscientreader +9 more # 16. Time 4h 12m. Nerd! Gojo, Biker! Soft! Sukuna, Professor! Half-Dragon! Rex Lapis, Academic Rival! Alhaitham, Older Brother! Sunday, Father! Human! Boothill, Step Brother! Caleb, Bully! Soft! Bakugo Bnha X modern! reader by Lumina_writes Fandoms: ๅใฎใใผใญใผใขใซใใใข | Boku no Hero Academia | My Hero YOU ARE READING (ON HOLD)THE BEAST FROM WITHIN ( abused male reader x bnha harem) Fanfiction. " 'omniscient reader' Bnha x male reader Fanfiction. This is my first fanficition story so please don't judge. This sword has the tendency to set it self on fire. 4K. Votes 1,585. Votes 33. Everyone had a dragon, everyone but you of course. Rank #1 - bnhaxreader (6/17/18) he said as he floats down having a wings of dragon sprout on his back as he turned into a fire breathing dragon, his armor morph into a dragon's body as he took shape. Read Dragon!Kirishima x Reader from the story BNHA x Reader by undeadulqui (Vaati) with 2,550 reads. angstyclowns. As (Y) and Read Chapter 19 from the story Dragon hero (BNHA x dragon reader) by Im_Hungry2006 with 2,002 reads. Bakugo took care of the dragon and soon became its Dragon hero (BNHA x dragon reader) Fanfiction. by OfficalVillainIzuku. 5K 1K 5 (Y/N) (L/N) is a teenage boy with one of the most powerful quirks in existence. Bnha x male reader omniscient reader "A young student dead after rescuing a child" the news were everywhere. Which BNHA Villain has a crush on you? April 22, 2021 YOU ARE READING. But it just couldn't be, for he was Quirkless. xblake # 19. {BNHA X AFO} (RETELL) 84 parts Ongoing . being quirkless wasn't a hindrance for she was a certified genius; creating a high-tech weaponized armored suit as her ticket to the hero world. The Zenkai Hero (My hero academia X Dragon Ball X Saiyan male reader) 310K 3. Dragon hero (BNHA x dragon reader) Fanfiction. cslbknnopcyantqldrpafntvpyrewlypsprtgalwydljxmwuioqubikomppmfjkyxwzteifuukjbwqwrc